PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59583.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family TALE
Protein Properties Length: 289aa    MW: 33188.7 Da    PI: 6.079
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59583.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-091652021954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  LA+++gL+ +qV +WF N R +
  EPS59583.1 165 FEHflHPYPKDSEKLVLARQTGLSRSQVANWFINARVR 202
                 665559******************************98 PP

2BELL84.71.1e-272594170
        BELL  1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiae 70
                er++l++k akL  +l eV++rY+ y++q+q ++ssF++ ag g++  Yts+A ++iSr+Fr L++ai +
  EPS59583.1 25 ERRDLREKVAKLSAMLGEVERRYRLYCDQMQDLVSSFDMSAGRGASSRYTSVAFRTISRQFRRLQNAIRK 94
                7899****************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.3E-9194IPR006563POX domain
PfamPF075266.1E-251992IPR006563POX domain
PROSITE profilePS5007112.066143206IPR001356Homeobox domain
SMARTSM003893.2E-9146210IPR001356Homeobox domain
CDDcd000864.31E-11146207No hitNo description
SuperFamilySSF466891.92E-17147213IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-27149212IPR009057Homeodomain-like
PfamPF059203.9E-17163202IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MNSVVAGDLD ANIDGDSGDG VSPSERRDLR EKVAKLSAML GEVERRYRLY CDQMQDLVSS  60
FDMSAGRGAS SRYTSVAFRT ISRQFRRLQN AIRKEMESCR RRLGERDDDK SSSSAVVLSR  120
LRHVDRHFYQ QQQQQQQKGY RIEQTWRPQR GLPETAVSIL RAWLFEHFLH PYPKDSEKLV  180
LARQTGLSRS QVANWFINAR VRLWKPMIEE MYREEFSEED EFGSKEPNSA SGFRQDDEDD  240
SNATAKNNDT TTENVSLELG LQKTTTASIS SISEAYYADA HLLSTDYVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-17152213566Homeobox protein Meis2
3k2a_B3e-17152213566Homeobox protein Meis2
4xrm_A3e-17152210563Homeobox protein Meis2
4xrm_B3e-17152210563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083613.11e-87PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011083614.11e-87PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011083616.11e-87PREDICTED: BEL1-like homeodomain protein 7
SwissprotO656855e-81BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLS8DA610.0S8DA61_9LAMI; Uncharacterized protein
STRINGOB03G14910.13e-82(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.27e-76BEL1-like homeodomain 6
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]